http://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&feed=atom&action=historyM1 Genomique Evolutive et Phylogenie - TP 2 Evolution proteine d'oomycete - Revision history2024-03-28T10:22:36ZRevision history for this page on the wikiMediaWiki 1.15.1http://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9050&oldid=prevGaulin: /* Exercice 2 */2022-02-15T12:30:13Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 12:30, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 81:</td>
<td colspan="2" class="diff-lineno">Line 81:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple.Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple.Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks). Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)''</div></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div> </div></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>''</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div></div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9049&oldid=prevGaulin: /* Exercice 2 */2022-02-15T12:29:40Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 12:29, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 81:</td>
<td colspan="2" class="diff-lineno">Line 81:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. <del class="diffchange diffchange-inline">''</del>Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple.Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9048&oldid=prevGaulin: /* Exercice 2 */2022-02-15T12:29:18Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 12:29, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 82:</td>
<td colspan="2" class="diff-lineno">Line 82:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. ''Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. ''Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)''</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)</div></td></tr>
<tr><td colspan="2"> </td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>''</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9047&oldid=prevGaulin: /* Exercice 2 */2022-02-15T12:28:42Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 12:28, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 81:</td>
<td colspan="2" class="diff-lineno">Line 81:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. <ins class="diffchange diffchange-inline">''</ins>Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)''</div></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>''</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div> </div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9046&oldid=prevGaulin: /* Exercice 2 */2022-02-15T12:28:20Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 12:28, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 82:</td>
<td colspan="2" class="diff-lineno">Line 82:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site [http://www.phylogeny.fr/ '''Phylogeny'''] dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td></tr>
<tr><td colspan="2"> </td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div><ins style="color: red; font-weight: bold; text-decoration: none;">Vous pouvez également utiliser MEGA (pour l'alignement multiple et la construction de l'arbre)</ins></div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9045&oldid=prevGaulin: /* Exercice 2 */2022-02-15T05:56:06Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 05:56, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 81:</td>
<td colspan="2" class="diff-lineno">Line 81:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site Phylogeny dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div>''NB: ou vous pouvez générer générer un arbre phylogénétique sur le site <ins class="diffchange diffchange-inline">[http://www.phylogeny.fr/ '''</ins>Phylogeny<ins class="diffchange diffchange-inline">'''] </ins>dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>''</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9044&oldid=prevGaulin: /* Exercice 2 */2022-02-15T05:55:19Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 05:55, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 81:</td>
<td colspan="2" class="diff-lineno">Line 81:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div>NB: ou vous pouvez générer générer un arbre phylogénétique <del class="diffchange diffchange-inline">de vos séquences : aller sur </del>sur le site Phylogeny dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div><ins class="diffchange diffchange-inline">''</ins>NB: ou vous pouvez générer générer un arbre phylogénétique sur le site Phylogeny dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</div></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div> </div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div><ins class="diffchange diffchange-inline">''</ins></div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9043&oldid=prevGaulin: /* Exercice 2 */2022-02-15T05:54:38Z<p><span class="autocomment">Exercice 2</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 05:54, 15 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 80:</td>
<td colspan="2" class="diff-lineno">Line 80:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Ouvrez votre alignement dans le logiciel de construction d'arbre (SeaView, ClustalW, [[Media:ClustalX.zip|ClustalX]])</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Ouvrez votre alignement dans le logiciel de construction d'arbre (SeaView, ClustalW, [[Media:ClustalX.zip|ClustalX]])</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?</div></td></tr>
<tr><td colspan="2"> </td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div><ins style="color: red; font-weight: bold; text-decoration: none;"></ins></div></td></tr>
<tr><td colspan="2"> </td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div><ins style="color: red; font-weight: bold; text-decoration: none;">NB: ou vous pouvez générer générer un arbre phylogénétique de vos séquences : aller sur sur le site Phylogeny dans Phylogeny Analysis => "Advanced" : décocher la case Multiple alignment et celle Gblocks, et cliquer sur Create workflow. Coller votre alignement multiple. Vous pouvez aussi utiliser le mode "One click" et mettre directement les séquences non alignées en format Fasta (là aussi décocher Gblocks).</ins></div></td></tr>
<tr><td colspan="2"> </td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div><ins style="color: red; font-weight: bold; text-decoration: none;"></ins></div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Gardez votre arbre affiché à l'écran ou sauvegardez-le</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>* Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9042&oldid=prevGaulin: /* Exercice 1 */2022-02-14T17:42:36Z<p><span class="autocomment">Exercice 1</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 17:42, 14 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 19:</td>
<td colspan="2" class="diff-lineno">Line 19:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>=Exercice 1=</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>=Exercice 1=</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div> ><del class="diffchange diffchange-inline">Physo_12_ABB22031.1</del></div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div> ><ins class="diffchange diffchange-inline">Physo_12</ins></div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> MKVLFATALTAAAVAVASAAEFCDQWGQAKSGNYIIYNNLWGSSAANPGGKQCTALDSGS</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> MKVLFATALTAAAVAVASAAEFCDQWGQAKSGNYIIYNNLWGSSAANPGGKQCTALDSGS</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> GDSVAWHTTWSWQGGDKSVKSFANAALEFDPVPLSEVKSIPSTMAYTVKSKGKAVTDVAY</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> GDSVAWHTTWSWQGGDKSVKSFANAALEFDPVPLSEVKSIPSTMAYTVKSKGKAVTDVAY</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulinhttp://www.m2p-bioinfo.ups-tlse.fr/site/index.php?title=M1_Genomique_Evolutive_et_Phylogenie_-_TP_2_Evolution_proteine_d%27oomycete&diff=9041&oldid=prevGaulin: /* Exercice 1 */2022-02-14T17:38:14Z<p><span class="autocomment">Exercice 1</span></p>
<table style="background-color: white; color:black;">
<col class='diff-marker' />
<col class='diff-content' />
<col class='diff-marker' />
<col class='diff-content' />
<tr valign='top'>
<td colspan='2' style="background-color: white; color:black;">← Older revision</td>
<td colspan='2' style="background-color: white; color:black;">Revision as of 17:38, 14 February 2022</td>
</tr>
<tr><td colspan="2" class="diff-lineno">Line 19:</td>
<td colspan="2" class="diff-lineno">Line 19:</td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>=Exercice 1=</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div>=Exercice 1=</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"></td></tr>
<tr><td class='diff-marker'>-</td><td style="background: #ffa; color:black; font-size: smaller;"><div> ><del class="diffchange diffchange-inline">Physo_12</del></div></td><td class='diff-marker'>+</td><td style="background: #cfc; color:black; font-size: smaller;"><div> ><ins class="diffchange diffchange-inline">Physo_12_ABB22031.1</ins></div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> MKVLFATALTAAAVAVASAAEFCDQWGQAKSGNYIIYNNLWGSSAANPGGKQCTALDSGS</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> MKVLFATALTAAAVAVASAAEFCDQWGQAKSGNYIIYNNLWGSSAANPGGKQCTALDSGS</div></td></tr>
<tr><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> GDSVAWHTTWSWQGGDKSVKSFANAALEFDPVPLSEVKSIPSTMAYTVKSKGKAVTDVAY</div></td><td class='diff-marker'> </td><td style="background: #eee; color:black; font-size: smaller;"><div> GDSVAWHTTWSWQGGDKSVKSFANAALEFDPVPLSEVKSIPSTMAYTVKSKGKAVTDVAY</div></td></tr>
<!-- diff generator: internal 2024-03-28 10:22:36 -->
</table>Gaulin